SCOPe 2.08: Domain d2wcua_: 2wcu A:

Lineage for d2wcua_ (2wcu A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.133: RbsD-like [102545] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest

4. Superfamily c.133.1: RbsD-like [102546] (2 families)

5. Family c.133.1.0: automated matches [191558] (1 protein)
   not a true family

6. Protein automated matches [190962] (7 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189111] (1 PDB entry)

8. Domain d2wcua_: 2wcu A: [169229]
   automated match to d2ob5a1
   complexed with fuc

Details for d2wcua_

PDB Entry: 2wcu, 1.9 Å

PDB Description: crystal structure of mammalian fucu

PDB Compounds: (A:) protein fucu homolog

SCOPe Domain Sequences for d2wcua_:

Sequence; same for both SEQRES and ATOM records:

>d2wcua_ c.133.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvalkgipkvlspellfalarmghgdeivladanfptssicqcgpveiradgldipqlle
avlrllpldtyvespaavmdlvpsdkekglqtpiwkryesllleadckktlmklerfefy
erakkafavvatgemalygniilkkgtld

Timeline for d2wcua_:

• d2wcua_ first appeared in SCOPe 2.01
  
• d2wcua_ appears in SCOPe 2.07