![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
![]() | Superfamily c.133.1: RbsD-like [102546] (2 families) ![]() |
![]() | Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
![]() | Protein automated matches [190962] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189111] (1 PDB entry) |
![]() | Domain d2wcua_: 2wcu A: [169229] automated match to d2ob5a1 complexed with fuc |
PDB Entry: 2wcu (more details), 1.9 Å
SCOPe Domain Sequences for d2wcua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wcua_ c.133.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mvalkgipkvlspellfalarmghgdeivladanfptssicqcgpveiradgldipqlle avlrllpldtyvespaavmdlvpsdkekglqtpiwkryesllleadckktlmklerfefy erakkafavvatgemalygniilkkgtld
Timeline for d2wcua_: