Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Escherichia coli [TaxId:562] [188952] (2 PDB entries) |
Domain d2wcia_: 2wci A: [169223] automated match to d1wika_ complexed with fes, gsh, na |
PDB Entry: 2wci (more details), 1.9 Å
SCOPe Domain Sequences for d2wcia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wcia_ c.47.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} msttiekiqrqiaenpillymkgspklpscgfsaqavqalaacgerfayvdilqnpdira elpkyanwptfpqlwvdgelvggcdiviemyqrgelqqliketaakykseepd
Timeline for d2wcia_: