Lineage for d2wcia_ (2wci A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370373Species Escherichia coli [TaxId:562] [188952] (2 PDB entries)
  8. 1370376Domain d2wcia_: 2wci A: [169223]
    automated match to d1wika_
    complexed with fes, gsh, na

Details for d2wcia_

PDB Entry: 2wci (more details), 1.9 Å

PDB Description: Structure of E. coli monothiol glutaredoxin GRX4 homodimer
PDB Compounds: (A:) glutaredoxin-4

SCOPe Domain Sequences for d2wcia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcia_ c.47.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
msttiekiqrqiaenpillymkgspklpscgfsaqavqalaacgerfayvdilqnpdira
elpkyanwptfpqlwvdgelvggcdiviemyqrgelqqliketaakykseepd

SCOPe Domain Coordinates for d2wcia_:

Click to download the PDB-style file with coordinates for d2wcia_.
(The format of our PDB-style files is described here.)

Timeline for d2wcia_: