SCOPe 2.03: Domain d2wcha_: 2wch A:

Lineage for d2wcha_ (2wch A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (6 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [189031] (7 PDB entries)

8. Domain d2wcha_: 2wch A: [169222]
   automated match to d1gm0a_
   complexed with b7m, mg

Details for d2wcha_

PDB Entry: 2wch, 1.7 Å

PDB Description: structure of bmori gobp2 (general odorant binding protein 2) with bombykal

PDB Compounds: (A:) general odorant-binding protein 1

SCOPe Domain Sequences for d2wcha_:

Sequence; same for both SEQRES and ATOM records:

>d2wcha_ a.39.2.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
taevmshvtahfgktleecreesglsvdildefkhfwsddfdvvhrelgcaiicmsnkfs
lmdddvrmhhvnmdeyiksfpngqvlaekmvklihncekqfdtetddctrvvkvaacfke
dsrkegiapevamveavieky

Timeline for d2wcha_:

• d2wcha_ first appeared in SCOPe 2.01
  
• d2wcha_ appears in SCOPe 2.02
  
• d2wcha_ appears in SCOPe 2.04
  
• d2wcha_ appears in the current release, SCOPe 2.08