Lineage for d2wcha_ (2wch A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711976Species Silkworm (Bombyx mori) [TaxId:7091] [189031] (7 PDB entries)
  8. 2711981Domain d2wcha_: 2wch A: [169222]
    automated match to d1gm0a_
    complexed with b7m, mg

Details for d2wcha_

PDB Entry: 2wch (more details), 1.7 Å

PDB Description: structure of bmori gobp2 (general odorant binding protein 2) with bombykal
PDB Compounds: (A:) general odorant-binding protein 1

SCOPe Domain Sequences for d2wcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcha_ a.39.2.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
taevmshvtahfgktleecreesglsvdildefkhfwsddfdvvhrelgcaiicmsnkfs
lmdddvrmhhvnmdeyiksfpngqvlaekmvklihncekqfdtetddctrvvkvaacfke
dsrkegiapevamveavieky

SCOPe Domain Coordinates for d2wcha_:

Click to download the PDB-style file with coordinates for d2wcha_.
(The format of our PDB-style files is described here.)

Timeline for d2wcha_: