| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
| Protein automated matches [190132] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries) |
| Domain d2wcff1: 2wcf F:1-89 [169221] Other proteins in same PDB: d2wcfa2, d2wcfb2, d2wcfc2, d2wcfe2, d2wcff2 automated match to d1odba_ complexed with na |
PDB Entry: 2wcf (more details), 2.78 Å
SCOPe Domain Sequences for d2wcff1:
Sequence, based on SEQRES records: (download)
>d2wcff1 a.39.1.2 (F:1-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyhth
>d2wcff1 a.39.1.2 (F:1-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikavideifqglda
nqdeqvdfqefislvaialkaahyhth
Timeline for d2wcff1: