SCOPe 2.08: Domain d2wcfe1: 2wcf E:1-89

Lineage for d2wcfe1 (2wcf E:1-89)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)

8. Domain d2wcfe1: 2wcf E:1-89 [169220]
   Other proteins in same PDB: d2wcfa2, d2wcfb2, d2wcfc2, d2wcfe2, d2wcff2
   automated match to d1odba_
   complexed with na

Details for d2wcfe1

PDB Entry: 2wcf, 2.78 Å

PDB Description: calcium-free (apo) s100a12

PDB Compounds: (E:) protein s100-a12

SCOPe Domain Sequences for d2wcfe1:

Sequence; same for both SEQRES and ATOM records:

>d2wcfe1 a.39.1.2 (E:1-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyhth

Timeline for d2wcfe1:

• d2wcfe1 first appeared in SCOPe 2.01, called d2wcfe_
  
• d2wcfe1 appears in SCOPe 2.07