Lineage for d1a8ha1 (1a8h A:349-500)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1487291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1487292Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1487321Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. Species Thermus thermophilus [TaxId:274] [47326] (1 PDB entry)
  8. 1487335Domain d1a8ha1: 1a8h A:349-500 [16922]
    Other proteins in same PDB: d1a8ha2
    complexed with zn

Details for d1a8ha1

PDB Entry: 1a8h (more details), 2 Å

PDB Description: methionyl-trna synthetase from thermus thermophilus
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1a8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8ha1 a.27.1.1 (A:349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

SCOPe Domain Coordinates for d1a8ha1:

Click to download the PDB-style file with coordinates for d1a8ha1.
(The format of our PDB-style files is described here.)

Timeline for d1a8ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8ha2