SCOPe 2.02: Domain d1a8ha1: 1a8h A:349-500

Lineage for d1a8ha1 (1a8h A:349-500)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
   this domain follows the Rossmann-fold catalytic domain of class I aaRS

7. Species Thermus thermophilus [TaxId:274] [47326] (4 PDB entries)

8. Domain d1a8ha1: 1a8h A:349-500 [16922]
   Other proteins in same PDB: d1a8ha2
   complexed with zn

Details for d1a8ha1

PDB Entry: 1a8h, 2 Å

PDB Description: methionyl-trna synthetase from thermus thermophilus

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1a8ha1:

Sequence; same for both SEQRES and ATOM records:

>d1a8ha1 a.27.1.1 (A:349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

Timeline for d1a8ha1:

• d1a8ha1 first appeared (with stable ids) in SCOP 1.55, called d1a8h_1
  
• d1a8ha1 appears in SCOPe 2.01
  
• d1a8ha1 appears in SCOPe 2.03
  
• d1a8ha1 appears in the current release, SCOPe 2.08