Lineage for d2wcfa1 (2wcf A:1-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710348Protein automated matches [190132] (4 species)
    not a true protein
  7. 2710351Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)
  8. 2710427Domain d2wcfa1: 2wcf A:1-90 [169216]
    Other proteins in same PDB: d2wcfa2, d2wcfb2, d2wcfc2, d2wcfe2, d2wcff2
    automated match to d1odba_
    complexed with na

Details for d2wcfa1

PDB Entry: 2wcf (more details), 2.78 Å

PDB Description: calcium-free (apo) s100a12
PDB Compounds: (A:) protein s100-a12

SCOPe Domain Sequences for d2wcfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcfa1 a.39.1.2 (A:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyhthk

SCOPe Domain Coordinates for d2wcfa1:

Click to download the PDB-style file with coordinates for d2wcfa1.
(The format of our PDB-style files is described here.)

Timeline for d2wcfa1: