Lineage for d2wceb_ (2wce B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1268673Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1268868Protein automated matches [190132] (3 species)
    not a true protein
  7. 1268871Species Human (Homo sapiens) [TaxId:9606] [187203] (20 PDB entries)
  8. 1268900Domain d2wceb_: 2wce B: [169215]
    automated match to d1odba_
    complexed with na

Details for d2wceb_

PDB Entry: 2wce (more details), 1.77 Å

PDB Description: calcium-free (apo) s100a12
PDB Compounds: (B:) protein s100-a12

SCOPe Domain Sequences for d2wceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wceb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefismvaialkaahyhthk

SCOPe Domain Coordinates for d2wceb_:

Click to download the PDB-style file with coordinates for d2wceb_.
(The format of our PDB-style files is described here.)

Timeline for d2wceb_: