Lineage for d2wcba_ (2wcb A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087651Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1087845Protein automated matches [190132] (4 species)
    not a true protein
  7. 1087853Species Human (Homo sapiens) [TaxId:9606] [187203] (20 PDB entries)
  8. 1087896Domain d2wcba_: 2wcb A: [169212]
    automated match to d1odba_
    complexed with na, zn

Details for d2wcba_

PDB Entry: 2wcb (more details), 1.73 Å

PDB Description: s100a12 complex with zinc in the absence of calcium
PDB Compounds: (A:) protein s100-a12

SCOPe Domain Sequences for d2wcba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcba_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthke

SCOPe Domain Coordinates for d2wcba_:

Click to download the PDB-style file with coordinates for d2wcba_.
(The format of our PDB-style files is described here.)

Timeline for d2wcba_: