SCOPe 2.02: Domain d2wc8d_: 2wc8 D:

Lineage for d2wc8d_ (2wc8 D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (20 PDB entries)

8. Domain d2wc8d_: 2wc8 D: [169211]
   automated match to d1odba_
   complexed with cit, na, zn

Details for d2wc8d_

PDB Entry: 2wc8, 1.88 Å

PDB Description: s100a12 complex with zinc in the absence of calcium

PDB Compounds: (D:) protein s100-a12

SCOPe Domain Sequences for d2wc8d_:

Sequence; same for both SEQRES and ATOM records:

>d2wc8d_ a.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifq
gldanqdeqvdfqefislvaialkaahyhthke

Timeline for d2wc8d_:

• d2wc8d_ first appeared in SCOPe 2.01
  
• d2wc8d_ appears in SCOPe 2.03
  
• d2wc8d_ appears in the current release, SCOPe 2.08, called d2wc8d1