SCOPe 2.04: Domain d2wc8c_: 2wc8 C:

Lineage for d2wc8c_ (2wc8 C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (33 PDB entries)

8. Domain d2wc8c_: 2wc8 C: [169210]
   automated match to d1odba_
   complexed with cit, na, zn

Details for d2wc8c_

PDB Entry: 2wc8, 1.88 Å

PDB Description: s100a12 complex with zinc in the absence of calcium

PDB Compounds: (C:) protein s100-a12

SCOPe Domain Sequences for d2wc8c_:

Sequence, based on SEQRES records:

>d2wc8c_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthke

Sequence, based on observed residues (ATOM records):

>d2wc8c_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
lanqdeqvdfqefislvaialkaahyhthke

Timeline for d2wc8c_:

• d2wc8c_ first appeared in SCOPe 2.01
  
• d2wc8c_ appears in SCOPe 2.03
  
• d2wc8c_ appears in SCOPe 2.05
  
• d2wc8c_ appears in the current release, SCOPe 2.08, called d2wc8c1