Lineage for d2wc8c_ (2wc8 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914282Protein automated matches [190132] (2 species)
    not a true protein
  7. 914283Species Human (Homo sapiens) [TaxId:9606] [187203] (16 PDB entries)
  8. 914309Domain d2wc8c_: 2wc8 C: [169210]
    automated match to d1odba_
    complexed with cit, na, zn

Details for d2wc8c_

PDB Entry: 2wc8 (more details), 1.88 Å

PDB Description: s100a12 complex with zinc in the absence of calcium
PDB Compounds: (C:) protein s100-a12

SCOPe Domain Sequences for d2wc8c_:

Sequence, based on SEQRES records: (download)

>d2wc8c_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthke

Sequence, based on observed residues (ATOM records): (download)

>d2wc8c_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
lanqdeqvdfqefislvaialkaahyhthke

SCOPe Domain Coordinates for d2wc8c_:

Click to download the PDB-style file with coordinates for d2wc8c_.
(The format of our PDB-style files is described here.)

Timeline for d2wc8c_: