SCOPe 2.06: Domain d2wc8a1: 2wc8 A:1-91

Lineage for d2wc8a1 (2wc8 A:1-91)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)

8. Domain d2wc8a1: 2wc8 A:1-91 [169208]
   Other proteins in same PDB: d2wc8a2, d2wc8b2, d2wc8c2, d2wc8d2
   automated match to d1odba_
   complexed with cit, na, zn

Details for d2wc8a1

PDB Entry: 2wc8, 1.88 Å

PDB Description: s100a12 complex with zinc in the absence of calcium

PDB Compounds: (A:) protein s100-a12

SCOPe Domain Sequences for d2wc8a1:

Sequence, based on SEQRES records:

>d2wc8a1 a.39.1.2 (A:1-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyhthke

Sequence, based on observed residues (ATOM records):

>d2wc8a1 a.39.1.2 (A:1-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
daqvdfqefislvaialkaahyhthke

Timeline for d2wc8a1:

• d2wc8a1 first appeared in SCOPe 2.01, called d2wc8a_
  
• d2wc8a1 was called d2wc8a_ in SCOPe 2.05
  
• d2wc8a1 appears in SCOPe 2.07
  
• d2wc8a1 appears in the current release, SCOPe 2.08