![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
![]() | Protein automated matches [191085] (10 species) not a true protein |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [189031] (7 PDB entries) |
![]() | Domain d2wc5a_: 2wc5 A: [169206] automated match to d1gm0a_ complexed with bom, mg |
PDB Entry: 2wc5 (more details), 1.9 Å
SCOPe Domain Sequences for d2wc5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wc5a_ a.39.2.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} taevmshvtahfgktleecreesglsvdildefkhfwsddfdvvhrelgcaiicmsnkfs lmdddvrmhhvnmdeyiksfpngqvlaekmvklihncekqfdtetddctrvvkvaacfke dsrkegiapevamveavieky
Timeline for d2wc5a_: