SCOPe 2.07: Domain d2wbwb_: 2wbw B:

Lineage for d2wbwb_ (2wbw B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d2wbwb_: 2wbw B: [169196]
   Other proteins in same PDB: d2wbwa_
   automated match to d1eaja_
   complexed with ca, sia

Details for d2wbwb_

PDB Entry: 2wbw, 1.55 Å

PDB Description: ad37 fibre head in complex with car d1 and sialic acid

PDB Compounds: (B:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2wbwb_:

Sequence; same for both SEQRES and ATOM records:

>d2wbwb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl

Timeline for d2wbwb_:

• d2wbwb_ first appeared in SCOPe 2.01
  
• d2wbwb_ appears in SCOPe 2.06
  
• d2wbwb_ appears in the current release, SCOPe 2.08