![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries) |
![]() | Domain d2wbwb_: 2wbw B: [169196] Other proteins in same PDB: d2wbwa_ automated match to d1eaja_ complexed with ca, sia |
PDB Entry: 2wbw (more details), 1.55 Å
SCOPe Domain Sequences for d2wbwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbwb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl
Timeline for d2wbwb_: