Lineage for d2wbvf_ (2wbv F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048518Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2048610Protein automated matches [190333] (4 species)
    not a true protein
  7. 2048611Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries)
  8. 2048617Domain d2wbvf_: 2wbv F: [169194]
    automated match to d2j1kc1
    complexed with gol, sia

Details for d2wbvf_

PDB Entry: 2wbv (more details), 1.9 Å

PDB Description: canine adenovirus 2 fibre head in complex with sialic acid
PDB Compounds: (F:) fiber protein

SCOPe Domain Sequences for d2wbvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbvf_ b.21.1.1 (F:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
paapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqf
slimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatis
rcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyv
genq

SCOPe Domain Coordinates for d2wbvf_:

Click to download the PDB-style file with coordinates for d2wbvf_.
(The format of our PDB-style files is described here.)

Timeline for d2wbvf_: