| Class b: All beta proteins [48724] (177 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
| Protein automated matches [190333] (4 species) not a true protein |
| Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries) |
| Domain d2wbve_: 2wbv E: [169193] automated match to d2j1kc1 complexed with gol, sia |
PDB Entry: 2wbv (more details), 1.9 Å
SCOPe Domain Sequences for d2wbve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbve_ b.21.1.1 (E:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq
Timeline for d2wbve_: