SCOPe 2.07: Domain d2wbvd_: 2wbv D:

Lineage for d2wbvd_ (2wbv D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein automated matches [190333] (6 species)
   not a true protein

7. Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries)

8. Domain d2wbvd_: 2wbv D: [169192]
   automated match to d2j1kc1
   complexed with gol, sia

Details for d2wbvd_

PDB Entry: 2wbv, 1.9 Å

PDB Description: canine adenovirus 2 fibre head in complex with sialic acid

PDB Compounds: (D:) fiber protein

SCOPe Domain Sequences for d2wbvd_:

Sequence; same for both SEQRES and ATOM records:

>d2wbvd_ b.21.1.1 (D:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
paapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqf
slimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatis
rcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyv
genq

Timeline for d2wbvd_:

• d2wbvd_ first appeared in SCOPe 2.01
  
• d2wbvd_ appears in SCOPe 2.06
  
• d2wbvd_ appears in the current release, SCOPe 2.08