Lineage for d1higc_ (1hig C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1993080Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 1993118Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 1993126Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 1993135Domain d1higc_: 1hig C: [16919]
    CA-atoms only

Details for d1higc_

PDB Entry: 1hig (more details), 3.5 Å

PDB Description: three-dimensional structure of recombinant human interferon-gamma.
PDB Compounds: (C:) interferon-gamma

SCOPe Domain Sequences for d1higc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1higc_ a.26.1.3 (C:) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
qdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spa

SCOPe Domain Coordinates for d1higc_:

Click to download the PDB-style file with coordinates for d1higc_.
(The format of our PDB-style files is described here.)

Timeline for d1higc_: