SCOPe 2.05: Domain d1higc_: 1hig C:

Lineage for d1higc_ (1hig C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)

8. Domain d1higc_: 1hig C: [16919]
   CA-atoms only

Details for d1higc_

PDB Entry: 1hig, 3.5 Å

PDB Description: three-dimensional structure of recombinant human interferon-gamma.

PDB Compounds: (C:) interferon-gamma

SCOPe Domain Sequences for d1higc_:

Sequence; same for both SEQRES and ATOM records:

>d1higc_ a.26.1.3 (C:) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
qdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spa

Timeline for d1higc_:

• d1higc_ first appeared (with stable ids) in SCOP 1.55
  
• d1higc_ appears in SCOPe 2.04
  
• d1higc_ appears in SCOPe 2.06
  
• d1higc_ appears in the current release, SCOPe 2.08