Lineage for d1higc_ (1hig C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441656Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 441657Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 441813Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 441832Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 441840Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 441849Domain d1higc_: 1hig C: [16919]

Details for d1higc_

PDB Entry: 1hig (more details), 3.5 Å

PDB Description: three-dimensional structure of recombinant human interferon-gamma.

SCOP Domain Sequences for d1higc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1higc_ a.26.1.3 (C:) Interferon-gamma {Human (Homo sapiens)}
qdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spa

SCOP Domain Coordinates for d1higc_:

Click to download the PDB-style file with coordinates for d1higc_.
(The format of our PDB-style files is described here.)

Timeline for d1higc_: