Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein automated matches [190333] (6 species) not a true protein |
Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries) |
Domain d2wbva_: 2wbv A: [169189] automated match to d2j1kc1 complexed with gol, sia |
PDB Entry: 2wbv (more details), 1.9 Å
SCOPe Domain Sequences for d2wbva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbva_ b.21.1.1 (A:) automated matches {Canine adenovirus 2 [TaxId: 10514]} aapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfs limefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisr cgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvg enq
Timeline for d2wbva_: