Lineage for d2wbgb_ (2wbg B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831434Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 2831606Protein automated matches [190245] (12 species)
    not a true protein
  7. 2831641Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)
  8. 2831649Domain d2wbgb_: 2wbg B: [169184]
    automated match to d1od0b_
    complexed with act, lgs

Details for d2wbgb_

PDB Entry: 2wbg (more details), 1.85 Å

PDB Description: Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine
PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d2wbgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbgb_ c.1.8.4 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d2wbgb_:

Click to download the PDB-style file with coordinates for d2wbgb_.
(The format of our PDB-style files is described here.)

Timeline for d2wbgb_: