Lineage for d1higa_ (1hig A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705824Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 2705832Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries)
  8. 2705840Domain d1higa_: 1hig A: [16917]
    CA-atoms only

Details for d1higa_

PDB Entry: 1hig (more details), 3.5 Å

PDB Description: three-dimensional structure of recombinant human interferon-gamma.
PDB Compounds: (A:) interferon-gamma

SCOPe Domain Sequences for d1higa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1higa_ a.26.1.3 (A:) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
qdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spa

SCOPe Domain Coordinates for d1higa_:

Click to download the PDB-style file with coordinates for d1higa_.
(The format of our PDB-style files is described here.)

Timeline for d1higa_: