![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily) 4 helices; bundle, partly opened |
![]() | Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families) ![]() this domain is the first in the fragment of known structure automatically mapped to Pfam PF02236 |
![]() | Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein) |
![]() | Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species) Single-stranded DNA-binding protein |
![]() | Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries) |
![]() | Domain d2wb0x1: 2wb0 X:177-265 [169164] Other proteins in same PDB: d2wb0x2, d2wb0x3 complexed with zn |
PDB Entry: 2wb0 (more details), 1.95 Å
SCOPe Domain Sequences for d2wb0x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wb0x1 a.54.1.1 (X:177-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]} ivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltfts nktfvtmmgrflqaylqsfaevtykhhep
Timeline for d2wb0x1: