Lineage for d2wb0x1 (2wb0 X:177-265)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715126Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily)
    4 helices; bundle, partly opened
  4. 2715127Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families) (S)
    this domain is the first in the fragment of known structure
    automatically mapped to Pfam PF02236
  5. 2715128Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein)
  6. 2715129Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species)
    Single-stranded DNA-binding protein
  7. 2715130Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries)
  8. 2715131Domain d2wb0x1: 2wb0 X:177-265 [169164]
    Other proteins in same PDB: d2wb0x2, d2wb0x3
    complexed with zn

Details for d2wb0x1

PDB Entry: 2wb0 (more details), 1.95 Å

PDB Description: 2.1 resolution structure of the c-terminal domain of the human adenovirus 5 ssdna binding protein
PDB Compounds: (X:) e2a DNA-binding protein

SCOPe Domain Sequences for d2wb0x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb0x1 a.54.1.1 (X:177-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
ivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltfts
nktfvtmmgrflqaylqsfaevtykhhep

SCOPe Domain Coordinates for d2wb0x1:

Click to download the PDB-style file with coordinates for d2wb0x1.
(The format of our PDB-style files is described here.)

Timeline for d2wb0x1: