SCOPe 2.08: Domain d2wa3a_: 2wa3 A:

Lineage for d2wa3a_ (2wa3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)

6. Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82196] (38 PDB entries)

8. Domain d2wa3a_: 2wa3 A: [169158]
   automated match to d1iz3a_
   complexed with a29, fe2

Details for d2wa3a_

PDB Entry: 2wa3, 2.5 Å

PDB Description: factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid

PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d2wa3a_:

Sequence; same for both SEQRES and ATOM records:

>d2wa3a_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
kvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d2wa3a_:

• d2wa3a_ first appeared in SCOPe 2.01
  
• d2wa3a_ appears in SCOPe 2.07