Lineage for d2w9tb_ (2w9t B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872381Species Staphylococcus aureus [TaxId:1280] [188848] (7 PDB entries)
  8. 1872393Domain d2w9tb_: 2w9t B: [169152]
    automated match to d1dhja_

Details for d2w9tb_

PDB Entry: 2w9t (more details), 2.35 Å

PDB Description: staphylococcus aureus s1:dhfr
PDB Compounds: (B:) dihydrofolate reductase type 1

SCOPe Domain Sequences for d2w9tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9tb_ c.71.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrrkg

SCOPe Domain Coordinates for d2w9tb_:

Click to download the PDB-style file with coordinates for d2w9tb_.
(The format of our PDB-style files is described here.)

Timeline for d2w9tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2w9ta_