SCOPe 2.05: Domain d2w9tb_: 2w9t B:

Lineage for d2w9tb_ (2w9t B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188848] (7 PDB entries)

8. Domain d2w9tb_: 2w9t B: [169152]
   automated match to d1dhja_

Details for d2w9tb_

PDB Entry: 2w9t, 2.35 Å

PDB Description: staphylococcus aureus s1:dhfr

PDB Compounds: (B:) dihydrofolate reductase type 1

SCOPe Domain Sequences for d2w9tb_:

Sequence; same for both SEQRES and ATOM records:

>d2w9tb_ c.71.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrrkg

Timeline for d2w9tb_:

• d2w9tb_ first appeared in SCOPe 2.01
  
• d2w9tb_ appears in SCOPe 2.04
  
• d2w9tb_ appears in SCOPe 2.06
  
• d2w9tb_ appears in the current release, SCOPe 2.08