![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [188848] (13 PDB entries) |
![]() | Domain d2w9tb_: 2w9t B: [169152] automated match to d1dhja_ |
PDB Entry: 2w9t (more details), 2.35 Å
SCOPe Domain Sequences for d2w9tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9tb_ c.71.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd tffppytfedwevessvegqldekntiphtflhlvrrkg
Timeline for d2w9tb_: