Lineage for d1fg9a_ (1fg9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1993080Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 1993118Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 1993126Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 1993131Domain d1fg9a_: 1fg9 A: [16915]
    Other proteins in same PDB: d1fg9c1, d1fg9c2, d1fg9d1, d1fg9d2, d1fg9e1, d1fg9e2

Details for d1fg9a_

PDB Entry: 1fg9 (more details), 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
PDB Compounds: (A:) interferon gamma

SCOPe Domain Sequences for d1fg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg9a_ a.26.1.3 (A:) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
lspaakt

SCOPe Domain Coordinates for d1fg9a_:

Click to download the PDB-style file with coordinates for d1fg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fg9a_: