Lineage for d1fg9a_ (1fg9 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 47066Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins)
  6. 47085Protein Interferon-gamma [47318] (3 species)
  7. 47093Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 47098Domain d1fg9a_: 1fg9 A: [16915]
    Other proteins in same PDB: d1fg9c1, d1fg9c2, d1fg9d1, d1fg9d2, d1fg9e1, d1fg9e2

Details for d1fg9a_

PDB Entry: 1fg9 (more details), 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

SCOP Domain Sequences for d1fg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg9a_ a.26.1.3 (A:) Interferon-gamma {Human (Homo sapiens)}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
lspaakt

SCOP Domain Coordinates for d1fg9a_:

Click to download the PDB-style file with coordinates for d1fg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fg9a_: