SCOPe 2.01: Domain d2w9se_: 2w9s E:

Lineage for d2w9se_ (2w9s E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (8 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188848] (5 PDB entries)

8. Domain d2w9se_: 2w9s E: [169149]
   automated match to d1dhja_
   complexed with gol, ndp, top

Details for d2w9se_

PDB Entry: 2w9s, 1.8 Å

PDB Description: staphylococcus aureus s1:dhfr in complex with trimethoprim

PDB Compounds: (E:) dihydrofolate reductase type 1 from tn4003

SCOPe Domain Sequences for d2w9se_:

Sequence; same for both SEQRES and ATOM records:

>d2w9se_ c.71.1.0 (E:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrr

Timeline for d2w9se_:

• d2w9se_ is new in SCOPe 2.01-stable
  
• d2w9se_ appears in SCOPe 2.02
  
• d2w9se_ appears in the current release, SCOPe 2.08