Lineage for d2w9sb_ (2w9s B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004553Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1004554Protein automated matches [190777] (8 species)
    not a true protein
  7. 1004622Species Staphylococcus aureus [TaxId:1280] [188848] (5 PDB entries)
  8. 1004625Domain d2w9sb_: 2w9s B: [169146]
    automated match to d1dhja_
    complexed with gol, ndp, top

Details for d2w9sb_

PDB Entry: 2w9s (more details), 1.8 Å

PDB Description: staphylococcus aureus s1:dhfr in complex with trimethoprim
PDB Compounds: (B:) dihydrofolate reductase type 1 from tn4003

SCOPe Domain Sequences for d2w9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9sb_ c.71.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrr

SCOPe Domain Coordinates for d2w9sb_:

Click to download the PDB-style file with coordinates for d2w9sb_.
(The format of our PDB-style files is described here.)

Timeline for d2w9sb_: