Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries) |
Domain d2w9ly_: 2w9l Y: [169142] Other proteins in same PDB: d2w9lc_, d2w9ld_, d2w9le_, d2w9lf_, d2w9lh_, d2w9li_, d2w9ll_, d2w9lm_, d2w9ln_, d2w9lq_, d2w9lr_, d2w9ls_ automated match to d1eaja_ |
PDB Entry: 2w9l (more details), 2.91 Å
SCOPe Domain Sequences for d2w9ly_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9ly_ b.1.1.1 (Y:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
Timeline for d2w9ly_: