SCOPe 2.07: Domain d1ekub2: 1eku B:123-241

Lineage for d1ekub2 (1eku B:123-241)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries)

8. Domain d1ekub2: 1eku B:123-241 [16914]
   biologically active single chain mutant
   complexed with so4; mutant

Details for d1ekub2

PDB Entry: 1eku, 2.9 Å

PDB Description: crystal structure of a biologically active single chain mutant of human ifn-gamma

PDB Compounds: (B:) interferon gamma

SCOPe Domain Sequences for d1ekub2:

Sequence; same for both SEQRES and ATOM records:

>d1ekub2 a.26.1.3 (B:123-241) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
pyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknfkd
dqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaels

Timeline for d1ekub2:

• d1ekub2 first appeared (with stable ids) in SCOP 1.55
  
• d1ekub2 appears in SCOPe 2.06
  
• d1ekub2 appears in the current release, SCOPe 2.08