Lineage for d1ekub2 (1eku B:123-241)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2754Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins)
  6. 2773Protein Interferon-gamma [47318] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 2789Domain d1ekub2: 1eku B:123-241 [16914]

Details for d1ekub2

PDB Entry: 1eku (more details), 2.9 Å

PDB Description: crystal structure of a biologically active single chain mutant of human ifn-gamma

SCOP Domain Sequences for d1ekub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekub2 a.26.1.3 (B:123-241) Interferon-gamma {Human (Homo sapiens)}
pyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknfkd
dqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaels

SCOP Domain Coordinates for d1ekub2:

Click to download the PDB-style file with coordinates for d1ekub2.
(The format of our PDB-style files is described here.)

Timeline for d1ekub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ekub1