Class b: All beta proteins [48724] (174 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) |
Protein automated matches [190333] (3 species) not a true protein |
Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries) |
Domain d2w9lq_: 2w9l Q: [169136] Other proteins in same PDB: d2w9la_, d2w9lb_, d2w9lg_, d2w9lj_, d2w9lk_, d2w9lo_, d2w9lp_, d2w9lt_, d2w9lv_, d2w9lx_, d2w9ly_, d2w9lz_ automated match to d2j1kc1 |
PDB Entry: 2w9l (more details), 2.91 Å
SCOPe Domain Sequences for d2w9lq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9lq_ b.21.1.1 (Q:) automated matches {Canine adenovirus 2 [TaxId: 10514]} apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge nq
Timeline for d2w9lq_: