Lineage for d2w9lp_ (2w9l P:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352643Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 2352644Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 2352658Domain d2w9lp_: 2w9l P: [169135]
    Other proteins in same PDB: d2w9lc_, d2w9ld_, d2w9le_, d2w9lf_, d2w9lh_, d2w9li_, d2w9ll_, d2w9lm_, d2w9ln_, d2w9lq_, d2w9lr_, d2w9ls_
    automated match to d1eaja_
    complexed with gal, gl0, sia

Details for d2w9lp_

PDB Entry: 2w9l (more details), 2.91 Å

PDB Description: canine adenovirus type 2 fibre head in complex with car domain d1 and sialic acid
PDB Compounds: (P:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2w9lp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9lp_ b.1.1.1 (P:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
vlv

SCOPe Domain Coordinates for d2w9lp_:

Click to download the PDB-style file with coordinates for d2w9lp_.
(The format of our PDB-style files is described here.)

Timeline for d2w9lp_: