| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
| Protein automated matches [190333] (6 species) not a true protein |
| Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries) |
| Domain d2w9lm_: 2w9l M: [169132] Other proteins in same PDB: d2w9la_, d2w9lb_, d2w9lg_, d2w9lj_, d2w9lk_, d2w9lo_, d2w9lp_, d2w9lt_, d2w9lv_, d2w9lx_, d2w9ly_, d2w9lz_ automated match to d2j1kc1 |
PDB Entry: 2w9l (more details), 2.91 Å
SCOPe Domain Sequences for d2w9lm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9lm_ b.21.1.1 (M:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq
Timeline for d2w9lm_: