Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein Interferon-gamma [47318] (3 species) intertwined dimer |
Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries) |
Domain d1ekub1: 1eku B:0-121 [16913] biologically active single chain mutant complexed with so4; mutant |
PDB Entry: 1eku (more details), 2.9 Å
SCOPe Domain Sequences for d1ekub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekub1 a.26.1.3 (B:0-121) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]} mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae fs
Timeline for d1ekub1: