Lineage for d2w9lh_ (2w9l H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943014Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 943015Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 943016Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
  6. 943057Protein automated matches [190333] (3 species)
    not a true protein
  7. 943058Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries)
  8. 943080Domain d2w9lh_: 2w9l H: [169127]
    Other proteins in same PDB: d2w9la_, d2w9lb_, d2w9lg_, d2w9lj_, d2w9lk_, d2w9lo_, d2w9lp_, d2w9lt_, d2w9lv_, d2w9lx_, d2w9ly_, d2w9lz_
    automated match to d2j1kc1

Details for d2w9lh_

PDB Entry: 2w9l (more details), 2.91 Å

PDB Description: canine adenovirus type 2 fibre head in complex with car domain d1 and sialic acid
PDB Compounds: (H:) fibre protein

SCOPe Domain Sequences for d2w9lh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9lh_ b.21.1.1 (H:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

SCOPe Domain Coordinates for d2w9lh_:

Click to download the PDB-style file with coordinates for d2w9lh_.
(The format of our PDB-style files is described here.)

Timeline for d2w9lh_: