SCOP 1.55: Domain d1ekua2: 1eku A:123-242

Lineage for d1ekua2 (1eku A:123-242)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins)

6. Protein Interferon-gamma [47318] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)

8. Domain d1ekua2: 1eku A:123-242 [16912]

Details for d1ekua2

PDB Entry: 1eku, 2.9 Å

PDB Description: crystal structure of a biologically active single chain mutant of human ifn-gamma

SCOP Domain Sequences for d1ekua2:

Sequence; same for both SEQRES and ATOM records:

>d1ekua2 a.26.1.3 (A:123-242) Interferon-gamma {Human (Homo sapiens)}
pyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknfkd
dqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelsp

Timeline for d1ekua2:

• d1ekua2 appears in SCOP 1.57
  
• d1ekua2 appears in the current release, SCOPe 2.08