SCOPe 2.06: Domain d2w9ea_: 2w9e A:

Lineage for d2w9ea_ (2w9e A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)

8. Domain d2w9ea_: 2w9e A: [169116]
   Other proteins in same PDB: d2w9el1, d2w9el2
   automated match to d1h0la_
   complexed with so4

Details for d2w9ea_

PDB Entry: 2w9e, 2.9 Å

PDB Description: structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2w9ea_:

Sequence; same for both SEQRES and ATOM records:

>d2w9ea_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresq

Timeline for d2w9ea_:

• d2w9ea_ first appeared in SCOPe 2.01
  
• d2w9ea_ appears in SCOPe 2.05
  
• d2w9ea_ appears in SCOPe 2.07
  
• d2w9ea_ appears in the current release, SCOPe 2.08