![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein automated matches [191016] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188783] (10 PDB entries) |
![]() | Domain d2w9ea_: 2w9e A: [169116] Other proteins in same PDB: d2w9eh_, d2w9el1, d2w9el2 automated match to d1h0la_ complexed with so4 |
PDB Entry: 2w9e (more details), 2.9 Å
SCOPe Domain Sequences for d2w9ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9ea_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti kqhtvttttkgenftetdvkmmervveqmcitqyeresq
Timeline for d2w9ea_: