Lineage for d2w9ea_ (2w9e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928689Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2928690Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2928691Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2928755Protein automated matches [191016] (9 species)
    not a true protein
  7. 2928764Species Human (Homo sapiens) [TaxId:9606] [188783] (10 PDB entries)
  8. 2928773Domain d2w9ea_: 2w9e A: [169116]
    Other proteins in same PDB: d2w9eh_, d2w9el1, d2w9el2
    automated match to d1h0la_
    complexed with so4

Details for d2w9ea_

PDB Entry: 2w9e (more details), 2.9 Å

PDB Description: structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2w9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9ea_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresq

SCOPe Domain Coordinates for d2w9ea_:

Click to download the PDB-style file with coordinates for d2w9ea_.
(The format of our PDB-style files is described here.)

Timeline for d2w9ea_: