| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein automated matches [190091] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries) |
| Domain d2w99b_: 2w99 B: [169115] automated match to d1blxa_ |
PDB Entry: 2w99 (more details), 2.8 Å
SCOPe Domain Sequences for d2w99b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w99b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atsryepvaeigvgaygtvykardphsghfvalksvrvpngeeglpistvrevallrrle
afehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpaetikdlmrqf
lrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmalapvvvtlwyrape
vllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppeddwprdvsl
prgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsyl
Timeline for d2w99b_: