Lineage for d2w99b_ (2w99 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043604Protein automated matches [190091] (8 species)
    not a true protein
  7. 1043667Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)
  8. 1043976Domain d2w99b_: 2w99 B: [169115]
    automated match to d1blxa_

Details for d2w99b_

PDB Entry: 2w99 (more details), 2.8 Å

PDB Description: crystal structure of cdk4 in complex with a d-type cyclin
PDB Compounds: (B:) cell division protein kinase 4

SCOPe Domain Sequences for d2w99b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w99b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atsryepvaeigvgaygtvykardphsghfvalksvrvpngeeglpistvrevallrrle
afehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpaetikdlmrqf
lrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmalapvvvtlwyrape
vllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppeddwprdvsl
prgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsyl

SCOPe Domain Coordinates for d2w99b_:

Click to download the PDB-style file with coordinates for d2w99b_.
(The format of our PDB-style files is described here.)

Timeline for d2w99b_: