SCOPe 2.01: Domain d2w8yb_: 2w8y B:

Lineage for d2w8yb_ (2w8y B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)

8. Domain d2w8yb_: 2w8y B: [169113]
   automated match to d1a28a_
   complexed with 486, edo, ndr, so4

Details for d2w8yb_

PDB Entry: 2w8y, 1.8 Å

PDB Description: ru486 bound to the progesterone receptor in a destabilized agonistic conformation

PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d2w8yb_:

Sequence; same for both SEQRES and ATOM records:

>d2w8yb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhkk

Timeline for d2w8yb_:

• d2w8yb_ is new in SCOPe 2.01-stable
  
• d2w8yb_ appears in SCOPe 2.02
  
• d2w8yb_ appears in the current release, SCOPe 2.08