SCOPe 2.08: Domain d2w8cb_: 2w8c B:

Lineage for d2w8cb_ (2w8c B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Phormidium laminosum [TaxId:32059] [49518] (8 PDB entries)

8. Domain d2w8cb_: 2w8c B: [169111]
   automated match to d1bawa_
   complexed with cu, zn

Details for d2w8cb_

PDB Entry: 2w8c, 1.8 Å

PDB Description: Plastocyanin variant with N-terminal Methionine - closed structure

PDB Compounds: (B:) plastocyanin

SCOPe Domain Sequences for d2w8cb_:

Sequence; same for both SEQRES and ATOM records:

>d2w8cb_ b.6.1.1 (B:) Plastocyanin {Phormidium laminosum [TaxId: 32059]}
metftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkl
shsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

Timeline for d2w8cb_:

• d2w8cb_ first appeared in SCOPe 2.01
  
• d2w8cb_ appears in SCOPe 2.07